ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI1311 suspect: LH U KOG4449 Intracellular trafficking, secretion, and vesicular transport Translocase of outer mitochondrial membrane complex, subunit TOM7

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI1311 462525 462346 -60  
         (60 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YNL070w [U] KOG4449 Translocase of outer mitochondrial membrane ... 84 5e-17 SPBC27B12.10c [U] KOG4449 Translocase of outer mitochondrial mem... 50 4e-07 >YNL070w [U] KOG4449 Translocase of outer mitochondrial membrane complex subunit TOM7 Length = 60 Score = 83.6 bits (205), Expect = 5e-17 Identities = 36/44 (81%), Positives = 40/44 (90%) Query: 1 MAFLPSFILSDESKERITKILNLTQTVAHYGWLPFILYLGWTHT 44 M+FLPSFILSDESKERI+KIL LT VAHYGW+PF+LYLGW HT Sbjct: 1 MSFLPSFILSDESKERISKILTLTHNVAHYGWIPFVLYLGWAHT 44 >SPBC27B12.10c [U] KOG4449 Translocase of outer mitochondrial membrane complex subunit TOM7 Length = 49 Score = 50.4 bits (119), Expect = 4e-07 Identities = 19/32 (59%), Positives = 27/32 (84%) Query: 9 LSDESKERITKILNLTQTVAHYGWLPFILYLG 40 +S+ESKER+ K+ N+ +TV HYGW+P IL+LG Sbjct: 3 ISEESKERLVKVFNIGKTVTHYGWIPLILWLG 34 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.327 0.140 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,534,209 Number of Sequences: 60738 Number of extensions: 58313 Number of successful extensions: 245 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 243 Number of HSP's gapped (non-prelim): 2 length of query: 60 length of database: 30,389,216 effective HSP length: 36 effective length of query: 24 effective length of database: 28,202,648 effective search space: 676863552 effective search space used: 676863552 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits)