ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI1586 suspect: LH R KOG1773 General function prediction only Stress responsive protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI1586 564866 564456 -137 
         (137 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDL123w [R] KOG1773 Stress responsive protein 113 8e-26 >YDL123w [R] KOG1773 Stress responsive protein Length = 140 Score = 113 bits (282), Expect = 8e-26 Identities = 65/140 (46%), Positives = 80/140 (56%), Gaps = 9/140 (6%) Query: 1 MCLCCICCTVSDLILYIVAIIFPPIAVGLRSGXXXXXXXXXXXXTMFGFLPGMIHAFYYI 60 MC C+CCTVSD ILYIVA FPP AV LRSG T+ GFLPGM+HAFYYI Sbjct: 1 MCCYCVCCTVSDFILYIVAFFFPPAAVLLRSGPCSSDFLLNVLLTLLGFLPGMLHAFYYI 60 Query: 61 TVTSPLRTDTETRYYYEQGWNDGQR---YGSPSAVTTVSHQPTGVEDP--LLPRTQIPLR 115 T+TSPLR + E YYY+QGW D +R P T ++P + P + PL Sbjct: 61 TITSPLR-NAEYVYYYQQGWVDSERNVPSNRPQNSQTPQNRPQQGSSARNVYPSVETPLL 119 Query: 116 Y--EPNNYAQDVPKGSPPPY 133 P++ Q + + SPPPY Sbjct: 120 QGAAPHDNKQSLVE-SPPPY 138 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.322 0.141 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,803,591 Number of Sequences: 60738 Number of extensions: 354513 Number of successful extensions: 874 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 872 Number of HSP's gapped (non-prelim): 1 length of query: 137 length of database: 30,389,216 effective HSP length: 95 effective length of query: 42 effective length of database: 24,619,106 effective search space: 1034002452 effective search space used: 1034002452 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits)