ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI1909 suspect: LH U KOG1761 Intracellular trafficking, secretion, and vesicular transport Signal recognition particle, subunit Srp14

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI1909 680589  681041 151  
         (151 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDL092w [U] KOG1761 Signal recognition particle subunit Srp14 57 7e-09 >YDL092w [U] KOG1761 Signal recognition particle subunit Srp14 Length = 146 Score = 57.4 bits (137), Expect = 7e-09 Identities = 35/118 (29%), Positives = 65/118 (54%), Gaps = 3/118 (2%) Query: 22 LSHDEFFVKLEKAFRMSKVSHNQLKVSLKRDLGSHHVQKPNELDVTSNPTGDISKMSESK 81 LS F K+ + F+ + H ++++ KR + V+ E D T++P D+SK ++ Sbjct: 7 LSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEGNLEFDSTNHPDYDVSK--KAS 64 Query: 82 RLKQNAQPDTKPYRLIVLVSMPYDGKRTKFFTLVDSKTLDKFWKDYVNVVKTSMSGLI 139 + +++ D + Y L++ +S K+TK T+V + LD+FW++Y +V K M LI Sbjct: 65 EISVSSRSD-REYPLLIRMSYGSHDKKTKCSTVVKASELDQFWQEYSSVFKGGMQNLI 121 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.314 0.131 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,410,787 Number of Sequences: 60738 Number of extensions: 323678 Number of successful extensions: 783 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 782 Number of HSP's gapped (non-prelim): 1 length of query: 151 length of database: 30,389,216 effective HSP length: 97 effective length of query: 54 effective length of database: 24,497,630 effective search space: 1322872020 effective search space used: 1322872020 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)