ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI1944 suspect: LH O KOG2447 Posttranslational modification, protein turnover, chaperones Oligosaccharyltransferase, delta subunit (ribophorin II)

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI1944 693035 692241 -265 
         (265 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YMR149w [O] KOG2447 Oligosaccharyltransferase delta subunit (rib... 86 7e-17 >YMR149w [O] KOG2447 Oligosaccharyltransferase delta subunit (ribophorin II) Length = 286 Score = 85.5 bits (210), Expect = 7e-17 Identities = 61/201 (30%), Positives = 107/201 (52%), Gaps = 19/201 (9%) Query: 59 SETLKLSFVVDQELE--QANVLVGLPSENLEAGYTLK-KQSGSSDKFSLAIPLPKLAHAF 115 +E ++++F ++ + Q +L+GLP++NLE + + K +G + I L KL A Sbjct: 63 NEVIQVNFAIESTNKPFQNTLLIGLPNKNLEMAFEPEIKDNGKLSMYKYRIDLAKLDAAL 122 Query: 116 NDRAE-----LQVNLLVSTE----ENSLVKELFILSIVDPVTNTRDTARNFVRLNPKEEI 166 A ++ L++++ + +L +E+ L++ V ++ + + + P EI Sbjct: 123 LQEASRSPEPIKATLILASSTAKPKENLFREILQLNLNFDVDHSDSSLVDKFGIKP--EI 180 Query: 167 HHIFQSSPKTVNAFIAQLFALVITTTLFVLFVSWVSFGAVNFN-----LKNVSSYLFVAL 221 HHIF + PK V IA +F L+I T+ L V+W++ A FN + V F+A Sbjct: 181 HHIFHAEPKRVAKPIAVIFVLIIFITILSLIVTWLNSCAAAFNNIPTGVTAVYFLGFIAT 240 Query: 222 VSGFEFIFYKYYSGTSIFDTV 242 + GFE IF +YY GTSIF+T+ Sbjct: 241 IVGFEVIFARYYLGTSIFETL 261 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.320 0.135 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,878,729 Number of Sequences: 60738 Number of extensions: 507262 Number of successful extensions: 1329 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1327 Number of HSP's gapped (non-prelim): 1 length of query: 265 length of database: 30,389,216 effective HSP length: 104 effective length of query: 161 effective length of database: 24,072,464 effective search space: 3875666704 effective search space used: 3875666704 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)