ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI1963 good R KOG4488 General function prediction only Small EDRK-rich protein H4F5

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI1963 699380 699180 -67  
         (67 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDL085c-a [R] KOG4488 Small EDRK-rich protein H4F5 84 5e-17 SPAC1705.02 [R] KOG4488 Small EDRK-rich protein H4F5 54 3e-08 HsM5032085 [R] KOG4488 Small EDRK-rich protein H4F5 50 4e-07 >YDL085c-a [R] KOG4488 Small EDRK-rich protein H4F5 Length = 68 Score = 83.6 bits (205), Expect = 5e-17 Identities = 40/46 (86%), Positives = 43/46 (92%) Query: 1 MARGNQRELARQKNLKKQQESGKNQKKQGDPKKRMESDAEILRQKQ 46 MARGNQR+LARQKNLKKQ++ KNQKK GDPKKRMESDAEILRQKQ Sbjct: 1 MARGNQRDLARQKNLKKQKDMAKNQKKSGDPKKRMESDAEILRQKQ 46 >SPAC1705.02 [R] KOG4488 Small EDRK-rich protein H4F5 Length = 63 Score = 54.3 bits (129), Expect = 3e-08 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Query: 1 MARGNQRELARQKNLKKQQESGKNQKKQGDPKKRMESDAEILRQKQQ 47 M+RGNQR++ R +NLKK Q S K K+ GDP KR+E+ AEI+R KQ+ Sbjct: 1 MSRGNQRDVDRARNLKKSQASKK--KQAGDPTKRLEAQAEIMRAKQR 45 >HsM5032085 [R] KOG4488 Small EDRK-rich protein H4F5 Length = 59 Score = 50.4 bits (119), Expect = 4e-07 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 2/49 (4%) Query: 1 MARGNQRELARQKNLKKQQESGKNQKKQG--DPKKRMESDAEILRQKQQ 47 M RGNQRELARQKN+KKQ +S K +++ R + D+EI++QKQ+ Sbjct: 1 MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQK 49 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.303 0.120 0.301 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,866,810 Number of Sequences: 60738 Number of extensions: 87643 Number of successful extensions: 1011 Number of sequences better than 1.0e-05: 3 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 1008 Number of HSP's gapped (non-prelim): 3 length of query: 67 length of database: 30,389,216 effective HSP length: 43 effective length of query: 24 effective length of database: 27,777,482 effective search space: 666659568 effective search space used: 666659568 T: 11 A: 40 X1: 17 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits)