ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI2285 suspect: LH C KOG3057 Energy production and conversion Cytochrome c oxidase, subunit VIb/COX12

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI2285 817837 817544 -98  
         (98 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs17442500 [C] KOG3057 Cytochrome c oxidase subunit VIb/COX12 46 8e-06 >Hs17442500 [C] KOG3057 Cytochrome c oxidase subunit VIb/COX12 Length = 125 Score = 46.2 bits (108), Expect = 8e-06 Identities = 26/74 (35%), Positives = 37/74 (49%), Gaps = 11/74 (14%) Query: 16 APSRSSRKQCWESRDLFFGCLDKISVVNALDPKHQKAIKASCSAEEAKFEQDCATSWISY 75 APS R+ CW +RD ++ CLD+ N D K +++S FE C WI Y Sbjct: 49 APSMKERQVCWGARDEYWKCLDE----NLEDASQCKKLRSS-------FESSCPQQWIKY 97 Query: 76 FKEKRVVDFKREKF 89 F ++R +EKF Sbjct: 98 FDKRRDYLKFKEKF 111 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.317 0.129 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,193,026 Number of Sequences: 60738 Number of extensions: 213270 Number of successful extensions: 665 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 664 Number of HSP's gapped (non-prelim): 1 length of query: 98 length of database: 30,389,216 effective HSP length: 74 effective length of query: 24 effective length of database: 25,894,604 effective search space: 621470496 effective search space used: 621470496 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)