ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI2296   suspect: LH   S     KOG0282  Function unknown                                               mRNA splicing factor

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI2296 821744 819837 -636 
         (636 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

7300806 [S] KOG0282 mRNA splicing factor                               51   6e-06

>7300806 [S] KOG0282 mRNA splicing factor
          Length = 576

 Score = 50.8 bits (120), Expect = 6e-06
 Identities = 23/72 (31%), Positives = 36/72 (49%)

Query: 306 YFEGRTAHYFKGHKSIVNHLVLNDEETRFLSGSWDKTVIEWDLETGTDITKFNATSQLSS 365
           Y E R    F GH+  +  +  N+  T FLS S+D+ +  WD ETG  +++F        
Sbjct: 316 YGERRCIRTFSGHRQAIKDIAWNNRGTNFLSASYDRYIKLWDAETGDVVSRFTTRKMPFC 375

Query: 366 LEFRPTNAAYEL 377
           ++F P N+   L
Sbjct: 376 VKFHPDNSKQHL 387


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.313    0.131    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 31,811,189
Number of Sequences: 60738
Number of extensions: 1335398
Number of successful extensions: 5341
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5338
Number of HSP's gapped (non-prelim): 3
length of query: 636
length of database: 30,389,216
effective HSP length: 113
effective length of query: 523
effective length of database: 23,525,822
effective search space: 12304004906
effective search space used: 12304004906
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)