ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI2400 suspect: LH R KOG0017 General function prediction only FOG: Transposon-encoded proteins with TYA, reverse transcriptase, integrase domains in various combinations

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI2400 856856 856470 -129 
         (129 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YER137c [R] KOG0017 FOG: Transposon-encoded proteins with TYA re... 79 1e-15 >YER137c [R] KOG0017 FOG: Transposon-encoded proteins with TYA reverse transcriptase integrase domains in various combinations Length = 148 Score = 79.3 bits (194), Expect = 1e-15 Identities = 46/139 (33%), Positives = 76/139 (54%), Gaps = 21/139 (15%) Query: 7 IIKQSEALDQLAKLVLSQSQKKQSTLPSLKEEYENKLKNVDELISMITSVE-------LD 59 I++ S+A+D LAKL++S KQ L+ EYE+KLK +++ I+++ + ++ Sbjct: 12 IVRLSQAMDVLAKLIIS----KQKDGSQLQVEYEHKLKELEKFINLLLGLHESTVGSMMN 67 Query: 60 KEKFSKMISKQIEIIQKDGQEYALIPVQRTPKQAKFGKR----------KSKANNIKCSY 109 ++ IEI++KD Q+YALIP++ + K K K N IKCS+ Sbjct: 68 TSVLDMVLRNGIEIMEKDDQKYALIPIKAKEEADKTTSTIQGVTSKKSSKKKKNKIKCSF 127 Query: 110 CNETGHLRSKCEKKLLGVP 128 C+E GH R+ C +L +P Sbjct: 128 CHEAGHTRAHCGARLTVIP 146 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.310 0.128 0.336 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,142,266 Number of Sequences: 60738 Number of extensions: 274010 Number of successful extensions: 1754 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1751 Number of HSP's gapped (non-prelim): 1 length of query: 129 length of database: 30,389,216 effective HSP length: 94 effective length of query: 35 effective length of database: 24,679,844 effective search space: 863794540 effective search space used: 863794540 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)