ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI2834   suspect: LH   R     KOG0017  General function prediction only                               FOG: Transposon-encoded proteins with TYA, reverse transcriptase, integrase domains in various combinations

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI2834 997512  999779 756  
         (756 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR034c [R] KOG0017 FOG: Transposon-encoded proteins with TYA re...    54   9e-07

>YDR034c [R] KOG0017 FOG: Transposon-encoded proteins with TYA reverse
           transcriptase integrase domains in various combinations
          Length = 790

 Score = 53.9 bits (128), Expect = 9e-07
 Identities = 21/45 (46%), Positives = 28/45 (61%)

Query: 12  GKKRKTRYSRKGCLQCKRSHLKCDEGQPKCGKCVKRNISCTYQLS 56
           G   K +YSR GC +CKR  +KCDE +P C +C + N  C Y L+
Sbjct: 147 GNTVKRKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQCVYVLN 191


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.323    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,634,999
Number of Sequences: 60738
Number of extensions: 1438242
Number of successful extensions: 3162
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3160
Number of HSP's gapped (non-prelim): 2
length of query: 756
length of database: 30,389,216
effective HSP length: 114
effective length of query: 642
effective length of database: 23,465,084
effective search space: 15064583928
effective search space used: 15064583928
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)