ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI3006 suspect: LH S KOG4415 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI3006 1059788 1057530 -753 
         (753 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value 7292701_2 [S] KOG4415 Uncharacterized conserved protein 52 3e-06 >7292701_2 [S] KOG4415 Uncharacterized conserved protein Length = 1643 Score = 52.0 bits (123), Expect = 3e-06 Identities = 43/177 (24%), Positives = 81/177 (45%), Gaps = 5/177 (2%) Query: 571 VKQWQNLRSLRPKYLFEFNKVSEKTTLAGFANEELIRNDIESKKRRLAERIESKKKKHSE 630 +K+ + L+ K E K EK EE +R +K + ER+E K+K E Sbjct: 833 IKEKEREEKLKEKLREEKIKEKEKEEKLRKEREEKMREKEREEKIKEKERVEKIKEKERE 892 Query: 631 QVAEAEQFFKDKEQERKDLLQAKIKSQRETLENGKNDKTTS--PDDQDNDSLKRRHDSPE 688 + + E+ ++K +E+++LL+ K K ++E E K + + + + LKR + + Sbjct: 893 EKLKKEK--EEKLKEKEELLKKKEKEEKEREEKLKEKERQEKLKEKEREEKLKRETEERQ 950 Query: 689 ADGNEEEQAVSKKQKLXXXXXXXXXXXXXQKEKALESEPTELKTIESTETEVEVPKE 745 + E E+ + +K++ +KE+ L+ + ELK E E + KE Sbjct: 951 RE-KEREEKLKEKERAEKLKDLEKEVKLKEKEEQLKEKEKELKLKEKKEKDKVKEKE 1006 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.315 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,323,862 Number of Sequences: 60738 Number of extensions: 1926410 Number of successful extensions: 10487 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 10439 Number of HSP's gapped (non-prelim): 16 length of query: 753 length of database: 30,389,216 effective HSP length: 114 effective length of query: 639 effective length of database: 23,465,084 effective search space: 14994188676 effective search space used: 14994188676 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits)