ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI4145 suspect: LH O KOG3496 Posttranslational modification, protein turnover, chaperones Cytochrome c oxidase assembly protein/Cu2+ chaperone COX17

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI4145 1446565 1446374 -64  
         (64 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YLL009c [O] KOG3496 Cytochrome c oxidase assembly protein/Cu2+ c... 65 2e-11 >YLL009c [O] KOG3496 Cytochrome c oxidase assembly protein/Cu2+ chaperone COX17 Length = 69 Score = 64.7 bits (156), Expect = 2e-11 Identities = 28/37 (75%), Positives = 30/37 (80%) Query: 28 EKEARDECLLFNGQESGKCDELIAKYKTCMKGYGFEV 64 EKE RD C+LFNGQ+S KC E I KYK CMKGYGFEV Sbjct: 29 EKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEV 65 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.310 0.129 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,320,462 Number of Sequences: 60738 Number of extensions: 87784 Number of successful extensions: 101 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 100 Number of HSP's gapped (non-prelim): 1 length of query: 64 length of database: 30,389,216 effective HSP length: 40 effective length of query: 24 effective length of database: 27,959,696 effective search space: 671032704 effective search space used: 671032704 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)