ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI4166 suspect: LH U KOG4697 Intracellular trafficking, secretion, and vesicular transport Integral membrane protein involved in transport between the late Golgi and endosome

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI4166 1454175 1453585 -197 
         (197 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YJL004c [U] KOG4697 Integral membrane protein involved in transp... 263 9e-71 7299060 [U] KOG4697 Integral membrane protein involved in transp... 59 3e-09 >YJL004c [U] KOG4697 Integral membrane protein involved in transport between the late Golgi and endosome Length = 203 Score = 263 bits (673), Expect = 9e-71 Identities = 123/202 (60%), Positives = 156/202 (76%), Gaps = 6/202 (2%) Query: 1 MASLRRYMRVPRELLPTEIFKQESQSPGKIIVQIILLQMFYYLTASTLFYCWAKICGYEI 60 M S+RRY+RVP EL P++IFKQ+S SP KI +QI+LLQ+FYY TA LFYCWAK+ GY++ Sbjct: 1 MVSIRRYLRVPNELKPSQIFKQDSLSPSKIGLQIVLLQIFYYTTAIVLFYCWAKLAGYDL 60 Query: 61 KLKQWLFTWQDIDFSNSFGISLSALWLIDSLICVFFLTIIVGRSKLAWDFAITIHAINLV 120 +K+WLF+W++IDF+N++G+S+S LWL+DSLICVFFLT+IVGRSKLAWDFAITIHAIN + Sbjct: 61 NIKEWLFSWENIDFTNAYGLSISLLWLLDSLICVFFLTVIVGRSKLAWDFAITIHAINFI 120 Query: 121 VVWTHTGLFPSLAWFILQFLSTLILIFLGTWITRWRELKDTFFEGMXXXXXXXXXXXXXX 180 VV+ +T FPS +WF LQ LS+LILIFLGTW TRWREL+DTFFEG+ Sbjct: 121 VVFLYTRKFPSFSWFFLQILSSLILIFLGTWTTRWRELRDTFFEGLVDPNEGEVGLVTPS 180 Query: 181 XXXXGKS------IELRDLEAQ 196 S I+L+DLE+Q Sbjct: 181 QQHSNHSELEQSPIQLKDLESQ 202 >7299060 [U] KOG4697 Integral membrane protein involved in transport between the late Golgi and endosome Length = 160 Score = 59.3 bits (142), Expect = 3e-09 Identities = 36/142 (25%), Positives = 69/142 (48%), Gaps = 2/142 (1%) Query: 20 FKQESQSPGKIIVQIILLQMFYYLTASTLFYCWAKICGYEIKLKQWLFTWQDIDFSNSFG 79 F+ P + QI+ +Q Y T L + K+ G L LF + +I + G Sbjct: 6 FRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDH-LFEYHEIHIYDMGG 64 Query: 80 ISLSALWLIDSLICVFFLTIIVGRSKLAWDFAITIHAINLVVVWTHTGLFPSLA-WFILQ 138 + +++++ + L IV R+KL DF+ T H ++L++ W + FP+ A W++L Sbjct: 65 RLVICAFVLNAFLASLALWCIVRRAKLCLDFSCTFHVLHLLICWWYNRSFPANASWWLLN 124 Query: 139 FLSTLILIFLGTWITRWRELKD 160 ++ I+ G ++ E+K+ Sbjct: 125 VITGTIMCIGGEFLCLQTEMKE 146 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.331 0.143 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,132,004 Number of Sequences: 60738 Number of extensions: 365370 Number of successful extensions: 1038 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1035 Number of HSP's gapped (non-prelim): 2 length of query: 197 length of database: 30,389,216 effective HSP length: 101 effective length of query: 96 effective length of database: 24,254,678 effective search space: 2328449088 effective search space used: 2328449088 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits)