ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI5131 good J KOG4612 Translation, ribosomal structure and biogenesis Mitochondrial ribosomal protein L34

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI5131 1782824  1783171 116  
         (116 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDR115w [J] KOG4612 Mitochondrial ribosomal protein L34 91 3e-19 SPBC21C3.04c [J] KOG4612 Mitochondrial ribosomal protein L34 63 6e-11 Hs13027606 [J] KOG4612 Mitochondrial ribosomal protein L34 47 4e-06 >YDR115w [J] KOG4612 Mitochondrial ribosomal protein L34 Length = 105 Score = 90.5 bits (223), Expect = 3e-19 Identities = 55/109 (50%), Positives = 68/109 (61%), Gaps = 10/109 (9%) Query: 8 LLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFGMLFDLTQ 67 L Q S+R +S SSFS L L + L N + S T FG++ Q Sbjct: 7 LCQPQSRRMFSSISSFSALSVLRPQTGMLL---NSSPLKTPSFTPLG----FGLI---GQ 56 Query: 68 RRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116 RRWKSRGNT+QPSTLKRKR GFLARA+S+ G +ILKRRK KGRW+L++ Sbjct: 57 RRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105 >SPBC21C3.04c [J] KOG4612 Mitochondrial ribosomal protein L34 Length = 108 Score = 63.2 bits (152), Expect = 6e-11 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 3/60 (5%) Query: 57 SIFGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116 +IFG + Q RWK+ GN +QPS KRKR+ GFL+R RS +G+++L+ R+ KGR YL++ Sbjct: 52 NIFGQM---QQVRWKTYGNEYQPSNRKRKRKHGFLSRIRSVNGRRVLRDRRQKGRMYLSH 108 >Hs13027606 [J] KOG4612 Mitochondrial ribosomal protein L34 Length = 92 Score = 47.0 bits (110), Expect = 4e-06 Identities = 22/50 (44%), Positives = 34/50 (68%) Query: 67 QRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116 Q R K+RGN +QPS +KRK + G++ R + +G Q++ RR KGR L++ Sbjct: 43 QARGKARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH 92 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.323 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,258,511 Number of Sequences: 60738 Number of extensions: 214850 Number of successful extensions: 723 Number of sequences better than 1.0e-05: 3 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 719 Number of HSP's gapped (non-prelim): 3 length of query: 116 length of database: 30,389,216 effective HSP length: 92 effective length of query: 24 effective length of database: 24,801,320 effective search space: 595231680 effective search space used: 595231680 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits)