ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI6103 suspect: LH R KOG0017 General function prediction only FOG: Transposon-encoded proteins with TYA, reverse transcriptase, integrase domains in various combinations

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI6103 2123577  2127068 1164 
         (1164 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YLR256w [R] KOG0017 FOG: Transposon-encoded proteins with TYA re... 52 5e-06 >YLR256w [R] KOG0017 FOG: Transposon-encoded proteins with TYA reverse transcriptase integrase domains in various combinations Length = 1502 Score = 52.0 bits (123), Expect = 5e-06 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 20/187 (10%) Query: 8 SCLVCRRRKVRCDRAKPVCLVCVKHGSNMECNY-------EVQKREVKFVSMKTPDVSNP 60 SC +CR+RKV+CD+ +P C C K G C+Y E +K +K +K Sbjct: 63 SCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRERVK 122 Query: 61 RMKKQKSFKYSIPFSGSTTVVKELDVLKQRIHSLE-SLLSKRNVSSTSDNMNYSPYVKIE 119 ++K S +S P S S + + S E + L N S S + + + Sbjct: 123 SLEKTLSKVHSSPSSNSLKSYNTPESSNLFMGSDEHTTLVNANTGSASSASHMHQQQQQQ 182 Query: 120 R------------NAHFGSNNVVPLDLSNYEDFNFYHNLETVDVKGGRLSFTGALNYISI 167 + NA+ S+++ + + ++ + + + + +K GA +++SI Sbjct: 183 QQQEQQQDFSRSANANANSSSLSISNKYDNDELDLTKDFDLLHIKSNGTIHLGATHWLSI 242 Query: 168 SKVDPYL 174 K DPYL Sbjct: 243 MKGDPYL 249 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.318 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,402,492 Number of Sequences: 60738 Number of extensions: 2876689 Number of successful extensions: 8520 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8517 Number of HSP's gapped (non-prelim): 3 length of query: 1164 length of database: 30,389,216 effective HSP length: 117 effective length of query: 1047 effective length of database: 23,282,870 effective search space: 24377164890 effective search space used: 24377164890 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)