ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI6524 suspect: LH U KOG4111 Intracellular trafficking, secretion, and vesicular transport Translocase of outer mitochondrial membrane complex, subunit TOM22

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI6524 2271371 2270910 -154 
         (154 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YNL131w [U] KOG4111 Translocase of outer mitochondrial membrane ... 87 9e-18 >YNL131w [U] KOG4111 Translocase of outer mitochondrial membrane complex subunit TOM22 Length = 152 Score = 87.0 bits (214), Expect = 9e-18 Identities = 43/83 (51%), Positives = 55/83 (65%) Query: 54 IYERLIALKDIIPPQKRKTISFLYNGTVSLFSSVFSKSGNLLWAVTTXXXXXXXXXXXXX 113 + +R++ALKDI+PP KR+TIS + T S + F+KSGNL W +TT Sbjct: 58 LLDRIVALKDIVPPGKRQTISNFFGFTSSFVRNAFTKSGNLAWTLTTTALLLGVPLSLSI 117 Query: 114 XAEQQLIEMEKSFDLQKDANDIL 136 AEQQLIEMEK+FDLQ DAN+IL Sbjct: 118 LAEQQLIEMEKTFDLQSDANNIL 140 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.313 0.130 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,496,983 Number of Sequences: 60738 Number of extensions: 131036 Number of successful extensions: 189 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 188 Number of HSP's gapped (non-prelim): 1 length of query: 154 length of database: 30,389,216 effective HSP length: 97 effective length of query: 57 effective length of database: 24,497,630 effective search space: 1396364910 effective search space used: 1396364910 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)