ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI6699 suspect: LH I KOG1505 Lipid transport and metabolism Lysophosphatidic acid acyltransferase LPAAT and related acyltransferases

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI6699 2331805 2330792 -338 
         (338 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value At3g18850 [I] KOG1505 Lysophosphatidic acid acyltransferase LPAA... 49 8e-06 >At3g18850 [I] KOG1505 Lysophosphatidic acid acyltransferase LPAAT and related acyltransferases Length = 375 Score = 49.3 bits (116), Expect = 8e-06 Identities = 50/166 (30%), Positives = 83/166 (49%), Gaps = 26/166 (15%) Query: 85 IWSVLREDI---QIIYEGETINTKCKNQ-LILSNHRSIIDY------TLIQSQFGAENVI 134 +W L E I ++I+ G+ + C+++ L+++NHR+ +D+ L + Q G N+ Sbjct: 68 LWPFLFEKINKTKVIFSGDKV--PCEDRVLLIANHRTEVDWMYFWDLALRKGQIG--NIK 123 Query: 135 FAGWTRLMKYPSFKHFWTIF------RHDENDNVSVSKI-KKFYGPEN---LVIFPEVNI 184 + + LMK P F + +F R E D ++ +I F P + L +FPE Sbjct: 124 YVLKSSLMKLPLFGWAFHLFEFIPVERRWEVDEANLRQIVSSFKDPRDALWLALFPEGTD 183 Query: 185 FTPEVKLIERKLMKLKYKGLPVLHNVLYPRFGTFVNLIKAFSNSND 230 +T E K K + GLP+L+NVL PR FV+ ++ S S D Sbjct: 184 YT-EAKCQRSKKFAAE-NGLPILNNVLLPRTKGFVSCLQELSCSLD 227 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.324 0.139 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,814,034 Number of Sequences: 60738 Number of extensions: 894317 Number of successful extensions: 2545 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2544 Number of HSP's gapped (non-prelim): 2 length of query: 338 length of database: 30,389,216 effective HSP length: 107 effective length of query: 231 effective length of database: 23,890,250 effective search space: 5518647750 effective search space used: 5518647750 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits)