ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI6778.1 suspect: LH A KOG0337 RNA processing and modification ATP-dependent RNA helicase

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI6778.1 2360924 2360787 -46  
         (46 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value At1g77030 [A] KOG0337 ATP-dependent RNA helicase 27 7.0 CE19684 [A] KOG2562 Protein phosphatase 2 regulatory subunit 26 9.2 >At1g77030 [A] KOG0337 ATP-dependent RNA helicase Length = 349 Score = 26.6 bits (57), Expect = 7.0 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Query: 15 YSVTAITSRFHRGDRGSTPRIGVFFLFFIS 44 Y V T F D GSTP G F+FFIS Sbjct: 308 YGVVVSTLDFESSDLGSTP--GRTFIFFIS 335 >CE19684 [A] KOG2562 Protein phosphatase 2 regulatory subunit Length = 1341 Score = 26.2 bits (56), Expect = 9.2 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Query: 3 SGNSYSSKVTIRYSVTA---ITSRFHRGDRGSTP 33 +GN Y S+ ++ + T+ +TS FHR STP Sbjct: 212 NGNGYPSQQRVQTTFTSNGPVTSTFHREYHNSTP 245 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.328 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,393,408 Number of Sequences: 60738 Number of extensions: 53835 Number of successful extensions: 97 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 97 Number of HSP's gapped (non-prelim): 2 length of query: 46 length of database: 30,389,216 effective HSP length: 22 effective length of query: 24 effective length of database: 29,052,980 effective search space: 697271520 effective search space used: 697271520 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits)