ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI7401 good TU KOG4076 Intracellular trafficking, secretion, and vesicular transport Regulator of ATP-sensitive K+ channels Alpha-endosulfine/ARPP-19 and related cAMP-regulated phosphoproteins r_klactVI7401 good TU KOG4076 Signal transduction mechanisms Regulator of ATP-sensitive K+ channels Alpha-endosulfine/ARPP-19 and related cAMP-regulated phosphoproteins

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI7401 2582212 2581763 -150 
         (150 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YHR132w-a [TU] KOG4076 Regulator of ATP-sensitive K+ channels Al... 137 5e-33 YNL157w [TU] KOG4076 Regulator of ATP-sensitive K+ channels Alph... 115 2e-26 SPAC10F6.16 [TU] KOG4076 Regulator of ATP-sensitive K+ channels ... 73 2e-13 >YHR132w-a [TU] KOG4076 Regulator of ATP-sensitive K+ channels Alpha-endosulfine/ARPP-19 and related cAMP-regulated phosphoproteins Length = 131 Score = 137 bits (345), Expect = 5e-33 Identities = 74/113 (65%), Positives = 92/113 (80%), Gaps = 10/113 (8%) Query: 22 SESVDP---KAPVANP-----ENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYF 73 SE + P + ++NP E VDLSKLSPQELK+YKMYGKLPSKKDL +HK+Q+R+YF Sbjct: 2 SEDLSPTSSRVDLSNPHGFTKEGVDLSKLSPQELKLYKMYGKLPSKKDLLRHKMQDRQYF 61 Query: 74 DSGDYALRRAGV-KSDDLQSSPVANNNLPLTNPSGLRESIIKRRMSSSANGPS 125 DSGDYAL++AGV KSDD+ + ++NNLP+TNPSGLRESII+RRMSSS+ G S Sbjct: 62 DSGDYALKKAGVIKSDDVIVNN-SSNNLPVTNPSGLRESIIRRRMSSSSGGDS 113 >YNL157w [TU] KOG4076 Regulator of ATP-sensitive K+ channels Alpha-endosulfine/ARPP-19 and related cAMP-regulated phosphoproteins Length = 168 Score = 115 bits (289), Expect = 2e-26 Identities = 55/85 (64%), Positives = 71/85 (82%), Gaps = 6/85 (7%) Query: 37 VDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGVKSDDLQSSPV- 95 +D SK SP E+K+YKMYGKLPSKKD+F+H +Q+RKYFDSGDYAL++AG++++D P+ Sbjct: 26 IDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAGIQNND----PIN 81 Query: 96 -ANNNLPLTNPSGLRESIIKRRMSS 119 NNLPLTNPS LRE IIKRR+S+ Sbjct: 82 YGKNNLPLTNPSKLREDIIKRRIST 106 >SPAC10F6.16 [TU] KOG4076 Regulator of ATP-sensitive K+ channels Alpha-endosulfine/ARPP-19 and related cAMP-regulated phosphoproteins Length = 139 Score = 72.8 bits (177), Expect = 2e-13 Identities = 33/55 (60%), Positives = 45/55 (81%), Gaps = 1/55 (1%) Query: 35 ENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQE-RKYFDSGDYALRRAGVKSD 88 + VD++KLSP+E K++++YG+LP +KDL KLQ+ RKYFDSGDYAL +AG SD Sbjct: 23 QKVDVAKLSPEEQKLFRLYGRLPQRKDLLVQKLQQGRKYFDSGDYALNKAGKASD 77 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.310 0.129 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,041,070 Number of Sequences: 60738 Number of extensions: 384456 Number of successful extensions: 1128 Number of sequences better than 1.0e-05: 3 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1123 Number of HSP's gapped (non-prelim): 3 length of query: 150 length of database: 30,389,216 effective HSP length: 97 effective length of query: 53 effective length of database: 24,497,630 effective search space: 1298374390 effective search space used: 1298374390 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)