Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0054 hypothetical protein SSO0054 
MLEHLIKISRRNWSSLKVIILAGGRGKRITLFKPFLVVCGKPLISWAFDAVNKLSDKVYLGINQSHPLFTIFKHSIFKIF
PTPDISYENDVKYVVESLGPPILVLPVDIAFINNNIINNLIERCAVDMCTLKSYGSYLGVTYWTGLNFSNYTDIEVKEKL
YNINTWEDYIKANKECNIL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897024 Gene name: - COG: H COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0054 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:suspect: LH M COG1208 Cell envelope biogenesis, outer membrane Nucleoside-diphosphate-sugar pyrophosphorylases involved in lipopolysaccharide biosynthesis/translation and initiation factor eIF2B subunits

CROSS REFERENCES:
pI: 8,85
MW: 20524,81
GenBank: 13813187