Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0067 30S ribosomal protein S2 
MKVTNLSEKEERGGELTEAEKEELRKSEKGAIIELLVPVDTYLSAGVHIGTHSCTKYMESFVYRVRAEGLYVLDVRKIDE
RLRIAAKFLSRYDPQDIIVVASRPYAYRPVQKFAEVVGSRALVGRIIPGTFTNPYLSTYIEPKVLLVSDPRTDTQAIKEA
AKVGIPIVAFADTDAKIDYIDLIIPANNKGRKSLALLYWALARQILRERRVIPPDGDLAVPVSEFEMRLVQ

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897033 Gene name: rps2AB COG: J COG0052 Ribosomal protein S2 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0067 hypothetical 1 rps2AB SSU ribosomal protein S2AB Translation 1 single function rps2 Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0052 Translation, ribosomal structure and biogenesis Ribosomal protein S2

CROSS REFERENCES:
pI: 9,04
MW: 26006,85
GenBank: 13813198