Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0069 LSU ribosomal protein L13AB (rpl13AB) 
MSTQVQEQVVIINAEGQILGRMASNVVRLLKEGKKVIIVNGEKAVISGEKNRVIESYKLLLTVKTLFNPYRNGIRRPRSP
INIVKRTIRGMLPKSSKGRRMLKNVKIYVGVPKEFEGRQFIKFPDSDVSRLKGKYVTVEVVSKELGWSG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897036 Gene name: rpl13AB COG: J COG0102 Ribosomal protein L13 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0069 confirmed 1 rpl13AB LSU ribosomal protein L13AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0102 Translation, ribosomal structure and biogenesis Ribosomal protein L13

CROSS REFERENCES:
pI: 11,35
MW: 16854,89
GenBank: 13813201