Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0073 30S ribosomal protein S4 
MGDPKKSRKKWETPGHPWIKERIGYEQELLGKYGLRNKREIWIAQSIIRKFRHQARSLLALPPAERAVREKQLVGKLLKM
GLLKKETATVDDILSLTEQDLLERRLQTIVYKKGLSNTIYQARQLITHGHIAVNGKRVTSPGYIVNVDEENLIDYYVTSS
FKSRPPVMSQQEGGEIGVKQA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897040 Gene name: rps4AB COG: J COG0522 Ribosomal protein S4 and related proteins Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0073 confirmed 1 rps4AB SSU ribosomal protein S4AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0522 Translation, ribosomal structure and biogenesis Ribosomal protein S4 and related proteins

CROSS REFERENCES:
pI: 10,71
MW: 20747,93
GenBank: 13813205
SCOP superfamily: => 
SCOP assignment: 28-150 2.9e-21 Alpha-L RNA-binding motif