Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0091 50S ribosomal protein L7Ae 
MNAMSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPY
VYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKTSS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897054 Gene name: rpl7AE COG: J COG1358 Ribosomal protein HS6-type (S12/L30/L7a) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0091 confirmed 1 rpl7AE LSU ribosomal protein L7AE Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG1358 Translation, ribosomal structure and biogenesis Ribosomal protein HS6-type (S12/L30/L7a)

CROSS REFERENCES:
pI: 8,07
MW: 14052,19
GenBank: 13813223
SCOP superfamily: => 
SCOP assignment: 14-117 2.0e-29 eL30-like