Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0099 hypothetical protein SSO0099 
MAQLRWLGHAATLLTFGNKNVIIDPMIKDNPLSPVKLDYFKNNLDIIIVTHDHYDHLGDTVELLRMNPKAKLFATYDLEA
HLAETYKISEESIIPANVGGFVEVDGIKLALTKAVHSSTHSDPTGAIVSAEGITVYHAGDTGLFEDMKLIGEVFKPDYAL
LPIGGRFTMDPYQASISVELIKPKKGAIPIHYNTWDLIKVDVNDFVKLVKNKGYNPIVLQPGQTITL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897060 Gene name: - COG: R COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0099 hypothetical 1 Conserved hypothetical protein 1 single function M. jannaschii MJ1163 04/22/01 00:00:00 terminal status:good R COG2220 General function prediction only Predicted Zn-dependent hydrolases of the beta-lactamase fold

CROSS REFERENCES:
pI: 6,24
MW: 25107,79
GenBank: 13813229
SCOP superfamily: => 
SCOP assignment: 3-222 3.0e-31 Metallo-hydrolase