Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0102 Esterase, tropinesterase related protein 
MLIHHLAGSYKSWKFVIPKLSLDNTVVAYDLRGHGRSSTPNSPYNIEDHSNDLRRLLVQLGIEKPVLIGHSIGSLIAIDY
ALKYPIEKLVLIGALYRAPSSEVYEKYVRIAVNFGMRALAEYRRFHKEFTETLASNYQAWNSLLEVYEETTPIGYKNAVE
GLLKAKDYSDELMGINAKTLIVYGTYDGLIVNLNVFKNNMKNVEIKTIDGYGHFLNFENPLLLSEIIKNFL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897063 Gene name: - COG: R COG0596 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0102 hypothetical 2 Esterase, tropinesterase related protein Uncategorized 1 single function 04/22/01 00:00:00 terminal status:normal R COG0596 General function prediction only Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

CROSS REFERENCES:
pI: 7,96
MW: 26293,05
GenBank: 13813234
SCOP superfamily: => 
SCOP assignment: 1-231 2.7e-48 alpha/beta-Hydrolases