Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0110 hypothetical protein SSO0110 
MQNLSPTQREILLALTDLYNRQKRMIKSKEVADIIGKDEGTVRNIILSLKVLGLVESKPGPNGGYMPTLKAYEIINNPTL
TPILDKLNLYKGMIETDIKVENIEIIDITNPSANRVLLKVEGDLRKLKIGDAVRLGPTPYSRLVIEGLILHLDENSKEIV
VDVKRMISIPKEKVKNLISKKLIALKPETSLREASMIFYKEAIRGAPVINQDEKVVGILTTADIIKAFFEGNYTAKVSDY
MKTNVISINENEDLLDAIRKMIIYNVGRLLVLDSNNKAVGIVTRTDILRSIAGLEGLWTT

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897070 Gene name: - COG: K COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0110 hypothetical 1 Conserved hypothetical protein 1 single function Contains CBS domain. Similarity with APE0974, MTH126, MJ1232, AF0111 04/22/01 00:00:00 terminal status:good R COG0517 General function prediction only CBS domains

CROSS REFERENCES:
pI: 9,91
MW: 33521,01
GenBank: 13813241
SCOP superfamily: => 
SCOP assignment: 1-65 1.8e-04 "Winged helix" DNA-binding domain
SCOP assignment: 176-233 1.1e-10 CBS-domain
SCOP assignment: 239-293 3.2e-11 CBS-domain