Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0116 DNA endonuclease III, probable (ntH-1) 
MKCTAETIFHKLSATYIIKEEDFIAYYVWLKTKDCFKVLVATILSQNSTDKSAIKAYLELERKVGVTPEKLSNANLADIE
SALKISGLYRTKAKRLKEISRIILERYNGLIDSLLNTSNARDELLKLEGIGEKTADVVLLTCYGYYGYKVFPVDTHITRV
SKRLGIVPTNAKYSLISSTLKELFSAYDLLHLHHMLIAHGRQTCKARKPLCNSCIIKECCEYYSHRDGEAWRSNTS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897075 Gene name: ntH-1 COG: L COG0177 Predicted EndoIII-related endonuclease Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0116 hypothetical 1 ntH-1 DNA endonuclease III, probable Replication and Repair 1 single function 4.2.99.18 04/22/01 00:00:00 terminal status:good L COG0177 DNA replication, recombination and repair Predicted EndoIII-related endonuclease

CROSS REFERENCES:
pI: 9,27
MW: 26842,83
GenBank: 13813246
SCOP superfamily: => 
SCOP assignment: 8-227 1.5e-56 DNA-glycosylase