Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0144 Arsenite transport protein (arsB) 
MLISALIVMVITYCLIISRSITKIPPWASMFFGGILMVILGIISPEEALQSINLDVILFLITLFTFASALEVSGFLKFLA
YKIIEKFKEPRKVLFYILLYSGLLSNLVTNDGVSASWTPVILELSRMIGVSEVPFLYALAVGVTIGSVIMPTGNPQNLLI
ALESGIKNPFITFTIYLTLPSIISLIIAYFILFRLFRKSLSLPSGINIKKEEEEKVDFDRRLGYLTLTLLVVTIILFFSL
SFFKIDILLGSLVTSSILLLLTEKRRDIVRRMDWPTILFFIGLFIFTDGVLKSGIIQYLSNFLPPPDSVASIMIVSILLS
QVLSNVPLVAIYIPIMISHSGITVVDWLALAAGSTIAGNFTILGAASNVIISEASESRGGKGFNFVEFMKYTIPILIPNA
IIIYLFLVLFR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897099 Gene name: arsB COG: P COG1055 Na+/H+ antiporter NhaD and related arsenite permeases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0144 hypothetical 1 arsB Arsenite transport protein Transport 1 single function Cell membrane transport 04/22/01 00:00:00 terminal status:good P COG1055 Inorganic ion transport and metabolism Arsenite permease

CROSS REFERENCES:
pI: 9,49
MW: 45549,09
GenBank: 13813276