Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0162 acetyl-lysine deacetylase 
MLQEKELVKQKAKELLLDLLSIYTPSKSEANATKFFEKISKDLNLKLEILPDSNSFILGEGDILLASHVDTVYGYIEPKI
ENELIYGRGAVDAKGPLISMIIATWLLNEKGIKVRVSGLADEESTSIGAKELIAKNYNFKYIIVGEPSNATDIVVEYRGS
IQLDIMCEGTPEHSSSAKNNLIVDISKKIIEVYKQPENYDKPSIVPTIIRAGESYNVTPAKLYLHLDIRYAINNKREDLI
KEITDKFPECNLKIVDETPPVKVSINNPVVKSLARALLKQNIKPRLVKKAGTSDMNILQRITTNIATYGPGNSMLEHTTQ
EKISLDEIYIGVKTYMLAIEELWQKI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897112 Gene name: - COG: E COG0624 Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0162 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:good E COG0624 Amino acid transport and metabolism Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases

CROSS REFERENCES:
pI: 6,22
MW: 38809,54
GenBank: 13813291
SCOP superfamily: => 
SCOP assignment: 2-344 1.3e-34 Zn-dependent exopeptidases
SCOP assignment: 158-254 2.3e-07 Carboxypeptidase G2, dimerisation domain