Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0164 30S ribosomal protein S8 
MGFYQGPDNRKITGGLKGKHRDKRKYEIGNPPTFTTLSAEDIRIKDRTLGGNFKVRLKYTTTANVLDPATNTAKKVKILE
ILETPANKELARRGIIIRGAKIRTEAGLAVVTSRPGQDGVINAVLLKNESQRS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897114 Gene name: rps8E COG: J COG2007 Ribosomal protein S8E Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0164 hypothetical 1 rps8E LSU ribosomal protein S8E Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG2007 Translation, ribosomal structure and biogenesis Ribosomal protein S8E

CROSS REFERENCES:
pI: 11,14
MW: 14658,81
GenBank: 13813293