Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0189 DNA ligase 
MEFKVIAEYFDKLEKISSRLQLTALLADLLSKSDKTIIDKVVYIIQGKLWPDFLGYPELGIGEKFLIKAISIATNTDENS
VENLYKTIGDLGEVARRLKSKQQSTGILGFLGTTSKESLTVDEVYSTLSKVALTTGEGSRDLKIRLLAGLLKKADPLEAK
FLVRFVEGRLRVGIGDATVLDAMAIAFGGGQSASEIIERAYNLRADLGNIAKIIVEKGIEALKTLKPQVGIPIRPMLAER
LSNPEEILKKMGGNAIVDYKYDGERAQIHKKEDKIFIFSRRLENITSQYPDVVDYVSKYIEGKEFIIEGEIVAIDPESGE
MRPFQELMHRKRKSDIYEAIKEYPVNVFLFDLMYYEDVDYTTKPLEARRKLLESIVKPNDYVKIAHHIQANNVEDLKSFF
YRAISEGGEGVMVKAIGKDAIYQAGARGWLWIKLKRDYQSEMADTVDLVVVGGFYGKGKRGGKISSLLMAAYNPKTDSFE
SVCKVASGFSDEQLDELQKKLMEIKRDVKHPRVNSKMEPDIWVEPVYVAEIIGSEITISPLHTCCQDVVEKDAGLSIRFP
RFIRWRDDKSPEDATTTDEILEMYNKQPKKKIESPAVDESV

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897140 Gene name: lig COG: L COG1793 ATP-dependent DNA ligase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0189 hypothetical 1 lig DNA ligase (polydeoxyribonucleotide synthase (ATP)) Replication and Repair 1 single function 6.5.1.1 04/22/01 00:00:00 terminal status:good L COG1793 DNA replication, recombination and repair ATP-dependent DNA ligase

CROSS REFERENCES:
pI: 5,96
MW: 67732,41
GenBank: 13813323
SCOP superfamily: => 
SCOP assignment: 229-435 5.7e-62 DNA ligase/mRNA capping enzyme, catalytic domain