Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0215 30S ribosomal protein S10 
MPTKARIRLWSTNVENLNYVITQIRGIVEKTGIEMRGPIPLPTSKLEVPIMRLPHGEGRKKWEKWEMRVHKRLIDIAADE
RVMRQLMRVRVPEDVYIEIQLI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897163 Gene name: rps10AB COG: J COG0051 Ribosomal protein S10 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0215 hypothetical 1 rps10AB SSU ribosomal protein S10AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0051 Translation, ribosomal structure and biogenesis Ribosomal protein S10

CROSS REFERENCES:
pI: 10,87
MW: 12112,33
GenBank: 13813350