Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0245 Heme biosynthesis nirD related protein (nirD) 
MNLVEISDIDKEILMKLEYEFPFDPQPFNIISDGLKISEEELLNRVKKLLEDGIIKRIGMYVSFRAKGMDGALIAARIPQ
DKIEKFRKIALGIRELTHNYVRDHPKFNIWFVLKANDRDTLNENVKELLSHVESNDYVILYSKKTLKLSVKYDVIRGVSW
SPNNTIRSLSKVPTAEELGINKQLLTELSYPLKISQRPFKEIAEKYKMKEDELVELIKELYDKNVIKDYGATLNGEKIGI
VENGMVLLDTSNVEQACEKLALNIPEATHVVLRESNDENWKYLCYSMIHASKKETIRNVAKEISKETNSRSYMILFSLEN
LKPGIVI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897190 Gene name: nirD COG: K COG1522 Transcriptional regulators Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0245 hypothetical 1 nirD Heme biosynthesis nirD related protein Cofactor Biosynthesis 1 single function Weak similarity with nirD heme biosynthesis protein homologs Heme 04/22/01 00:00:00 terminal status:suspect: LH K COG1522 Transcription Transcriptional regulators, Lrp family

CROSS REFERENCES:
pI: 7,06
MW: 37727,37
GenBank: 13813383