Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0255 Nicotinamide mononucleotide adenylyltransferase, putative 
MIRNSLKDVGMDLSRIYIIPMPDILMNNIWAHYVSTYTPKFEVVFARNPLVVRIFKEAGYKVEIPPAFNREKYNSTYIRR
LIILNDNWSELVPKPVYKYILEIKGDQRLREIVGTDK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897199 Gene name: - COG: H COG1056 Nicotinamide mononucleotide adenylyltransferase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0255 hypothetical 1 Nicotinamide mononucleotide adenylyltransferase, putative Cofactor Biosynthesis 1 single function 2.7.7.1 Amino-end extention is missing compared to other homologues Pyridine nucleotides 04/22/01 00:00:00 terminal status:good H COG1056 Coenzyme metabolism Nicotinamide mononucleotide adenylyltransferase

CROSS REFERENCES:
pI: 10,34
MW: 13864,15
GenBank: 13813394
SCOP superfamily: => 
SCOP assignment: 1-105 1.3e-10 Nucleotidylyl transferase