Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0266 Transcription Factor E (TFE), TFIIE alpha subunit homolog (tfE) 
MVNAEDLFINLAKSLLGDDVIDVLRILLDKGTEMTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRDKDSGWFIYYW
KPNIDQINEILLNRKRLILDKLKTRLEYEKNNTFFICPQDNSRYSFEEAFENEFKCLKCGSQLTYYDTDKIKSFLEQKIR
QIEEEIDKETKLGANKNH

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897210 Gene name: tfE COG: K COG1675 Transcription initiation factor IIE, alpha subunit Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0266 hypothetical 1 tfE Transcription Factor E (TFE), TFIIE alpha subunit homolog Transcription 1 single function RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG1675 Transcription Transcription initiation factor IIE, large subunit

CROSS REFERENCES:
pI: 5,12
MW: 21172,91
GenBank: 13813405
SCOP superfamily: => 
SCOP assignment: 6-83 3.7e-09 "Winged helix" DNA-binding domain