Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0270 Multiprotein Bridging Factor (MBP-like), putative (MBP-like) 
MQANSEEYCELCGSQIRGKGITVSYEGSIITVCNSCYDRIRKHAVIVKADSKKSETRKKATLKPPKMENAELEIVTDYYK
IIKTAREQLGISQQQLAQKLKVSENIVKRFESGKLKPTISQARQLEKILGIKLVTPLENNEESEKEFDDTGLTLGDVVNI
KEGKK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897213 Gene name: MBP-like COG: K COG1813 Predicted transcription factor, homolog of eukaryotic MBF1 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0270 hypothetical 1 MBP-like Multiprotein Bridging Factor (MBP-like), putative Transcription 1 single function Similar to APE2011, PH0783, AF1977, MTH729, PAB0842, Ta0948, MJ0586 04/22/01 00:00:00 terminal status:good K COG1813 Transcription Predicted transcription factor, homolog of eukaryotic MBF1

CROSS REFERENCES:
pI: 9,2
MW: 18563,24
GenBank: 13813408
SCOP superfamily: => 
SCOP assignment: 74-133 8.1e-11 lambda repressor-like DNA-binding domains