Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0273 hypothetical protein SSO0273 
MSNVKIVIKKDLSELKGSTFITGFRTIGEVGYLAIRHLALKRKMERIGYVVTKYYRDVTFLDDYGIATPFDIFYDKDKHL
VLLLNHILPFQREWNDFAS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897216 Gene name: - COG: R COG1938 Archaeal enzymes of ATP-grasp superfamily Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0273 hypothetical 1 Hypothetical protein 1 single function Possible frameshift with SSO5544. 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 10,04
MW: 11618,44
GenBank: 13813413