Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0278 Proteasome subunit 
MEELPATAVGLKVNDGIVLASERRLSYGGYVLSKQAKKVYKINKFLMAGAGIYGDLQTLTRIMNVEIKYYEVSTGKPISV
HAAAKLLSVILYQYKVMPFISEILFGGVDEKGPQLYVLDPIGSLIEDNYAAVGSGARIAIGVLESEYDPNMSLDVATQLI
TKAIKASIERDITSGDGIDLAIIDKKGNYENKFIPY

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897221 Gene name: - COG: O COG0638 20S proteasome, alpha and beta subunits Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0278 hypothetical 1 psmB Proteasome beta subunit precursor (multicatalytic endopeptidase complex beta subunit) Proteases 1 single function 3.4.99.46 04/22/01 00:00:00 terminal status:good O COG0638 Posttranslational modification, protein turnover, chaperones Proteasome protease subunit HslV

CROSS REFERENCES:
pI: 5,43
MW: 21375,57
GenBank: 13813418
SCOP superfamily: => 
SCOP assignment: 7-190 4.6e-56 N-terminal nucleophile aminohydrolases (Ntn hydrolases)