Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0291 putative DNA-directed RNA polymerase subunit M 
MIVVKFCPKCNSMMVPKKSNGKNVYRCTKCGYEKEVPETTIVVTSKVKHSIKEKTLVLEEEEMPSGAQKIKGVLCPSCKN
DEAYFWILQTRRADEPPTRFYKCTKCGKVWREYE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897234 Gene name: rpoM-1 COG: K COG1594 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0291 hypothetical 1 rpoM-1 DNA-directed RNA polymerase, subunit M Transcription 1 single function 2.7.7.6 Possible in-frame shift with SSO5576. Similar to carboxy-end of RPOM_SULAC, but most other thermophilic genes are the same size RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG1594 Transcription DNA-directed RNA polymerase subunit M/Transcription elongation factor TFIIS

CROSS REFERENCES:
pI: 9,07
MW: 13205,47
GenBank: 13813433
SCOP superfamily: => 
SCOP assignment: 75-114 2.4e-14 Zinc beta-ribbon