Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0326 NADH dehydrogenase subunit I 
MEIFLSLSFSFLIIRCGGGLFMDKVKEYKKENIASLFAEHIQSIVTGIKYFVKPQRITLQYPEDSLTLPTGYRGMIRLYK
DVCIGCTLCALICPADAMKMVTESGKKFPQINYGRCVFCGFCVDVCPVDALKETKVHDLVFNNRKQLIFDPDRFNVDIDD
VPMQDKPVRKVKAIIDEKRGIKYVPADE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897266 Gene name: NuoI COG: C COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0326 hypothetical 1 fpoI Quinone reductase subunit FpoI (NuoI-like) Energy Metabolism 1 single function Electron transport 04/22/01 00:00:00 terminal status:good C COG1143 Energy production and conversion Formate hydrogenlyase subunit 6/NADH-ubiquinone oxidoreductase 23 kD subunit (chain I), NuoI/NQO9/FrxB

CROSS REFERENCES:
pI: 7,96
MW: 21435,06
GenBank: 13813471
SCOP superfamily: => 
SCOP assignment: 15-134 4.3e-15 4Fe-4S ferredoxins