Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0346 LSU ribosomal protein L11AB (rpl11AB) 
MNKVPIKTIKIMVEGGNVKPGPPLAPTLSQLGLNVGEVVKKLNEATSSFKGMSVPVTIEVDSSTKKYEIKVGIPTTTALL
LKEAGASEPSGDPAHKKIGNLSLEQVIKIAIMKKPGLTTKSLKAALKSMLGTAKSIGLTVDNRDPKELVKEVEEGKYDDL
LAKYENEWNGVKE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897280 Gene name: rpl11AB COG: J COG0080 Ribosomal protein L11 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0346 hypothetical 1 rpl11AB LSU ribosomal protein L11AB Translation 10 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0080 Translation, ribosomal structure and biogenesis Ribosomal protein L11

CROSS REFERENCES:
pI: 10,03
MW: 18523,55
GenBank: 13813487
SCOP superfamily: => 
SCOP assignment: 67-142 5.1e-18 Ribosomal protein L11, C-terminal domain
SCOP assignment: 8-71 4.5e-15 Ribosomal protein L11, N-terminal domain