Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0360 Cysteine synthase B (cysM) 
MSNPLHVFSNEQELLEGMWPTPLLKLRIGNDTWAKLEFYNPFSRSVKDRTAWFLFRQALLKNATHIVEATSGNTGIALAS
LSSIFGMRFTMFLPVVAPKVYKVFVKLLGGNVIEAGNSTNDVIPLVKKFAEMTNALNLDQFNNPINVIAHYETTAREIDE
QLSSIGKKPSRIIATMGTGGHIAGIAKYFKEKYGNDVEIIGVQPSENSRIPGIKRQNGSNSLLRDVKIDRVVDVSLEEAI
DGTISVARTSGILIGISAGATVAAYKKISDVSSTTVLIFPDDAFKYVDILEQTLKEI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897295 Gene name: cysM COG: E COG0031 Cysteine synthase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0360 hypothetical 2 cysM Cysteine synthase B Amino Acid Biosynthesis 52 single function 4.2.99.8 04/22/01 00:00:00 terminal status:good E COG0031 Amino acid transport and metabolism Cysteine synthase/cystathionine beta-synthase

CROSS REFERENCES:
pI: 8,91
MW: 32622,24
GenBank: 13813504
SCOP superfamily: => 
SCOP assignment: 14-290 5.1e-60 Tryptophan synthase beta subunit-like PLP-dependent enzymes