Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0405 Proliferating cell nuclear antigen homolog (PCNA) (pcnA-1) 
MIYLKSFERNIRLINMKVVYDDVRVLKDIIQALARLVDEAVLKFKQDSVELVALDRAHISLISVNLPREMFKEYDVNDEF
KFGFNTQYLMKILKVAKRKEAIEIASESPDSVIINIIGSTNREFNVRNLEVSEQEIPEINLQFDISATISSDGFKSAISE
VSTVTDNVVVEGHEDRILIKAEGESEVEVEFSKDTGGLQDLEFSKESKNSYSAEYLDDVLSLTKLSDYVKISFGNQKPLQ
LFFNMEGGGKVTYLLAPKV

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897339 Gene name: pcnA-1 COG: L COG0592 DNA polymerase sliding clamp subunit (PCNA homolog) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0405 hypothetical 1 pcnA-1 Proliferating cell nuclear antigen homolog (PCNA) Replication and Repair 46 single function 04/22/01 00:00:00 terminal status:good L COG0592 DNA replication, recombination and repair DNA polymerase III beta subunit

CROSS REFERENCES:
pI: 4,61
MW: 29351,18
GenBank: 13813558
SCOP superfamily: => 
SCOP assignment: 135-259 4.2e-20 DNA clamp
SCOP assignment: 16-136 3.3e-20 DNA clamp