Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0449 hypothetical protein SSO0449 
MSLLIRLAKFALVGGLGTIVNEVTYVLASKTIPIGVSLAIAIEISLIFNFVLNDIWTFKDKRNNSYLNRLLKFHGSSYLG
NIVQYIVALVLLVYLLHISSISDAVFILFFSKLAASTFTLVLTNFIGIVSGFVVRFITSLKYVWA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897380 Gene name: - COG: S COG2246 Predicted membrane protein Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0449 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with AF0615 and carboxy-end of some dolichol phosphate mannosyltransferases 04/22/01 00:00:00 terminal status:suspect: LH S COG2246 Function unknown Uncharacterized membrane protein

CROSS REFERENCES:
pI: 10,65
MW: 16112,06
GenBank: 13813605