Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0479 hypothetical protein SSO0479 
MYRRKPNPYVKLINGDKIIDVGCGSGQNCDQFKGRLVICLDLSLNQLNQARKKGCQNLVQADMEYLPFRDSSVDSLAYIA
SLHHLRDPSQALGEAQRVLKDKGEILVTVWLVQLKFFFLRRYIIKRSLINGKEVRRFYRLYYPWELKRIMESKGFVTKIY
KLYRVNSLLPNNSLYYGIKSTA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897405 Gene name: - COG: QR COG0500 SAM-dependent methyltransferases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0479 hypothetical 1 Conserved hypothetical protein 1 hypothetical 04/22/01 00:00:00 terminal status:good R COG0500 General function prediction only SAM-dependent methyltransferases

CROSS REFERENCES:
pI: 10,66
MW: 21276,71
GenBank: 13813634
SCOP superfamily: => 
SCOP assignment: 8-176 1.4e-23 S-adenosyl-L-methionine-dependent methyltransferases