Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0553 hypothetical protein SSO0553 
MKILIVKSENGKVTSEKVAEGEISKVLRDVAKEALEEWNELASDFIIMRDNQEVRLPLPLKPEVYEAIKTFLIGKDKKEA
IAKIPVYIISYENEWKESDFQDKKIYVVSFYINDEIKKDVLNDAAQMTSEQKQEELKEELEEEEEE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897475 Gene name: - COG: S COG5399 Uncharacterized protein conserved in archaea Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0553 putative 2 Conserved hypothetical protein single function 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 4,38
MW: 17058,23
GenBank: 13813718