Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0571 Glutamine amidotransferase, putative 
MKIGIIAYQGSFEEHFLQLKRAFDKLSLNGEIISIKIPKDLKGVDGVIIPGGESTTIGLVAKRLGLLDELKEKITSGLPV
LGTCAGAIMLAKEVSDAKVGKTSQPLIGTMNISVIRNYYGRQKESFEAIVDLSKIGKDKAHVVFIRAPAIAKVWGKAQSL
AELNGVTVFAEENNMLATTFHPELSDTTSIHEYFLHLVKG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897492 Gene name: - COG: H COG0311 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0571 putative 1 Glutamine amidotransferase, putative Amino Acid Biosynthesis 1 hypothetical Close homology to imidazoleglycerol phosphate synthase, subunit h, putative 04/22/01 00:00:00 terminal status:good F COG0311 Nucleotide transport and metabolism Glutamine amidotransferase (possibly involved in histidine and purine biosynthesis)

CROSS REFERENCES:
pI: 9,06
MW: 21693,13
GenBank: 13813737
SCOP superfamily: => 
SCOP assignment: 1-200 6.3e-25 Class I glutamine amidotransferases (GAT)