Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0632 Amidophosphoribosyltransferase (glutamine phosphoribosylpyrophosphate amidotransferase) (ATase) (GPAT) (purF-1) 
MDSIRDKCGVFAVSSPKEVNIQLVVEGIRLLQHRGQESAGIAYAENGEILTIKGSGLVDEVFKENLNKFIKNGIGHVRYS
TSGKSSIEEAQPLGDSKIVVAFNGTISNYYQFGSFRVDTEFIYKFFKQKLAFRSIPDTVKEFMKVVDGGYSVAILLNDEE
IVVFRDPKGFHPVVLGFLEGSLIVSSEDSVIRQLGGSVLKHILPSEMIIMKNGKILYDKVIYEEKNYATCSFEYIYFARP
DSNIDGHSVYLARIRLGELLAEKHPANGDIVVPVPDSSRPIALGFSRKSHIPLEEPLVRTISSVRSFIMPTQDKRNEVLE
EKFGVVADAVRGKRIVLIDDSIVRGNTMKRIITMLRKAGAKEIHVRIGSPMIKYPCYMGIDFPKREELIAHNKSEKEIGN
ELNADSIEFLSVEEMLQGIGRRDLCNACFSGIYPLKFNYNSTELERIFGK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897546 Gene name: purF-1 COG: F COG0034 Glutamine phosphoribosylpyrophosphate amidotransferase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0632 putative 1 purF-1 Amidophosphoribosyltransferase (glutamine phosphoribosylpyrophosphate amidotransferase) (ATase) (GPAT) Purines single function 2.4.2.14 04/22/01 00:00:00 terminal status:good F COG0034 Nucleotide transport and metabolism Glutamine phosphoribosylpyrophosphate amidotransferase

CROSS REFERENCES:
pI: 7,52
MW: 50493,77
GenBank: 13813799
SCOP superfamily: => 
SCOP assignment: 230-440 1.9e-53 PRTase-like
SCOP assignment: 8-236 9.5e-46 N-terminal nucleophile aminohydrolases (Ntn hydrolases)