Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0665 NADH dehydrogenase subunit B (NuoB) 
MTEQTILMGNLNEVAKKAAQWLINRKPIKSIIDWGISFSLWPPHFTTSCCGTEFGAFAAARFDAERYGMLPFSSARQSNI
LILEGTLSRKMGRAARIVYDQMPEPKYVIALGACILEGGIFWNSYNTVLPSDIGIPVDLYVPGCPIRPEAVARAVLMLQK
KIRTQGALKT

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897574 Gene name: NuoB COG: C COG0377 NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S oxidoreductases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0665 hypothetical 1 fpoB Quinone reductase subunit FpoB (NuoB-like) Energy Metabolism 1 single function Electron transport 04/22/01 00:00:00 terminal status:good C COG0377 Energy production and conversion NADH:ubiquinone oxidoreductase 20 kD subunit NuoB/Nqo6/NdhK and related Fe-S oxidoreductases

CROSS REFERENCES:
pI: 9,8
MW: 18822,87
GenBank: 13813833
SCOP superfamily: => 
SCOP assignment: 31-163 1.7e-40 Nickel-iron hydrogenase, small subunit