Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0689 hypothetical protein SSO0689 
MTEMKILIVTLTYIEKSIIDEIVNNLSSYGLEVDILLDSRKYLPISAFNWERLQYDAEKVLSFLKSIHDFNYDSIIFLAD
SDGYIDGYNFVFGLTIDNFAIIFLHRLREEFYNRKPDLDLFMKRVVKEVTHEVGHTLGLSHCNTTGCVMNFSNSVEDVDK
KQAKFCKNCAHKIEKLSKYLQQK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897594 Gene name: - COG: R COG1913 Predicted Zn-dependent proteases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0689 hypothetical 1 Conserved hypothetical protein 1 single function 04/22/01 00:00:00 terminal status:good R COG1913 General function prediction only Predicted Zn-dependent proteases

CROSS REFERENCES:
pI: 6,25
MW: 21339,35
GenBank: 13813857
SCOP superfamily: => 
SCOP assignment: 17-169 2.5e-12 Metalloproteases ("zincins"), catalytic domain